PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028438m
Common NameCICLE_v10028435mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 448aa    MW: 48431.3 Da    PI: 10.1758
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028438mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.84.8e-13369412548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  +
  Ciclev10028438m 369 RRHRRMIKNRESAARSRARKQAYTLELEAEVAKLKELNQELERK 412
                      699***********************************999632 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-9365423IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358367412IPR004827Basic-leucine zipper domain
PfamPF001706.0E-11369418IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-12369414No hitNo description
CDDcd147072.80E-24369415No hitNo description
SuperFamilySSF579594.43E-9369414No hitNo description
PROSITE patternPS000360372387IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGSQMNYKNV GDTSYGDGKQ AGNFPLARQP SVYSLTFEEF QNTWGGLGKD FGSMNMDELL  60
KNIWTAEESH AMNSSAGAAG ESNAPGGNLQ RQGSLTLPRT LSQKTVDEVW RDLMKEGSGG  120
AAAGGGGGSN VPQRQQTLGE MTLEEFLVRA GVVREDAQQI GGSLNNAGFY ANNNTSLALG  180
FQQPSRNNGL IGNRIMEDGS SVPSQPPSLA LNVNGIRSSQ QPQQQPQQHQ YQLQQQQQPQ  240
LQQHPYQQQQ RQQQQAPLFP KQATVAFASP MNLVNTTQLS SPGARGQVVT VTNSSMNGNL  300
VQAGGLQGGG MGMVGLGAGG VTLATGSQVA QVSPDMIAKS TADVSSPSPV PYVFGRGRKS  360
GALEKVVERR HRRMIKNRES AARSRARKQA YTLELEAEVA KLKELNQELE RKQAEKIEME  420
KNKIIEKMKY RWGGKILCLR RTLTGPW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.12930.0fruit| vegetative tissue
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1717030.0HM171703.1 Citrus trifoliata ABA responsive element binding factor (ABF) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423014.10.0hypothetical protein CICLE_v10028435mg
RefseqXP_006423008.10.0hypothetical protein CICLE_v10028435mg
RefseqXP_006423010.10.0hypothetical protein CICLE_v10028435mg
SwissprotQ9M7Q31e-121AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A067F0W30.0A0A067F0W3_CITSI; Uncharacterized protein
TrEMBLV4UAG80.0V4UAG8_9R
STRINGPOPTR_0009s10400.11e-174(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.24e-88abscisic acid responsive elements-binding factor 3